Lineage for d2a2ld1 (2a2l D:4-145)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731881Superfamily d.110.9: GlcG-like [143744] (1 family) (S)
    alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain
  5. 731882Family d.110.9.1: GlcG-like [143745] (1 protein)
    Pfam PF03928; DUF336
  6. 731883Protein DhaI homolog [143746] (1 species)
  7. 731884Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry)
  8. 731888Domain d2a2ld1: 2a2l D:4-145 [126038]
    automatically matched to 2A2L A:4-145

Details for d2a2ld1

PDB Entry: 2a2l (more details), 2.2 Å

PDB Description: crystal structure of klebsiella pneumoniae protein orfy, pfam duf336
PDB Compounds: (D:) unknown

SCOP Domain Sequences for d2a2ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ld1 d.110.9.1 (D:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]}
mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
sggtveqdqllaqcaldcfsal

SCOP Domain Coordinates for d2a2ld1:

Click to download the PDB-style file with coordinates for d2a2ld1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ld1: