Lineage for d2a2ld2 (2a2l D:4-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971181Superfamily d.110.9: GlcG-like [143744] (1 family) (S)
    alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain
    automatically mapped to Pfam PF03928
  5. 2971182Family d.110.9.1: GlcG-like [143745] (1 protein)
    Pfam PF03928; DUF336
  6. 2971183Protein DhaI homolog [143746] (1 species)
  7. 2971184Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry)
    Uniprot Q48422 2-143
  8. 2971188Domain d2a2ld2: 2a2l D:4-145 [126038]
    Other proteins in same PDB: d2a2la2, d2a2la3, d2a2lb3, d2a2lb4, d2a2lc3, d2a2ld3
    automated match to d2a2la1

Details for d2a2ld2

PDB Entry: 2a2l (more details), 2.2 Å

PDB Description: crystal structure of klebsiella pneumoniae protein orfy, pfam duf336
PDB Compounds: (D:) unknown

SCOPe Domain Sequences for d2a2ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ld2 d.110.9.1 (D:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]}
mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
sggtveqdqllaqcaldcfsal

SCOPe Domain Coordinates for d2a2ld2:

Click to download the PDB-style file with coordinates for d2a2ld2.
(The format of our PDB-style files is described here.)

Timeline for d2a2ld2: