Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.9: GlcG-like [143744] (1 family) alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain automatically mapped to Pfam PF03928 |
Family d.110.9.1: GlcG-like [143745] (1 protein) Pfam PF03928; DUF336 |
Protein DhaI homolog [143746] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry) Uniprot Q48422 2-143 |
Domain d2a2ld2: 2a2l D:4-145 [126038] Other proteins in same PDB: d2a2la2, d2a2la3, d2a2lb3, d2a2lb4, d2a2lc3, d2a2ld3 automated match to d2a2la1 |
PDB Entry: 2a2l (more details), 2.2 Å
SCOPe Domain Sequences for d2a2ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2ld2 d.110.9.1 (D:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]} mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv sggtveqdqllaqcaldcfsal
Timeline for d2a2ld2: