SCOPe 2.01: Domain d2a2lc_: 2a2l C:

Lineage for d2a2lc_ (2a2l C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.9: GlcG-like [143744] (1 family)
   alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain

5. Family d.110.9.1: GlcG-like [143745] (1 protein)
   Pfam PF03928; DUF336

6. Protein DhaI homolog [143746] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry)
   Uniprot Q48422 2-143

8. Domain d2a2lc_: 2a2l C: [126037]
   automated match to d2a2la1

Details for d2a2lc_

PDB Entry: 2a2l, 2.2 Å

PDB Description: crystal structure of klebsiella pneumoniae protein orfy, pfam duf336

PDB Compounds: (C:) unknown

SCOPe Domain Sequences for d2a2lc_:

Sequence; same for both SEQRES and ATOM records:

>d2a2lc_ d.110.9.1 (C:) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]}
mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
sggtveqdqllaqcaldcfsale

Timeline for d2a2lc_:

• d2a2lc_ first appeared in SCOP 1.73, called d2a2lc1
  
• d2a2lc_ was called d2a2lc1 in SCOP 1.75
  
• d2a2lc_ appears in SCOPe 2.02
  
• d2a2lc_ appears in the current release, SCOPe 2.08, called d2a2lc2