SCOP 1.75: Domain d2a2lc1: 2a2l C:4-145

Lineage for d2a2lc1 (2a2l C:4-145)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.9: GlcG-like [143744] (1 family)
   alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain

5. Family d.110.9.1: GlcG-like [143745] (1 protein)
   Pfam PF03928; DUF336

6. Protein DhaI homolog [143746] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry)
   Uniprot Q48422 2-143

8. Domain d2a2lc1: 2a2l C:4-145 [126037]
   automatically matched to 2A2L A:4-145

Details for d2a2lc1

PDB Entry: 2a2l, 2.2 Å

PDB Description: crystal structure of klebsiella pneumoniae protein orfy, pfam duf336

PDB Compounds: (C:) unknown

SCOP Domain Sequences for d2a2lc1:

Sequence; same for both SEQRES and ATOM records:

>d2a2lc1 d.110.9.1 (C:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]}
mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
sggtveqdqllaqcaldcfsal

Timeline for d2a2lc1:

• d2a2lc1 first appeared in SCOP 1.73
  
• d2a2lc1 is called d2a2lc_ in SCOPe 2.01
  
• d2a2lc1 appears in the current release, SCOPe 2.08, called d2a2lc2