![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.110: Profilin-like [55769] (9 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.9: GlcG-like [143744] (1 family) ![]() alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain |
![]() | Family d.110.9.1: GlcG-like [143745] (1 protein) Pfam PF03928; DUF336 |
![]() | Protein DhaI homolog [143746] (1 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry) |
![]() | Domain d2a2lb1: 2a2l B:4-145 [126036] automatically matched to 2A2L A:4-145 |
PDB Entry: 2a2l (more details), 2.2 Å
SCOP Domain Sequences for d2a2lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2lb1 d.110.9.1 (B:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]} mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv sggtveqdqllaqcaldcfsal
Timeline for d2a2lb1: