SCOP 1.73: Domain d2a2lb1: 2a2l B:4-145

Lineage for d2a2lb1 (2a2l B:4-145)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.9: GlcG-like [143744] (1 family)
   alpha-beta(2)-alpha(3)-beta(2)-alpha; similar to the Roadblock/LC7 domain

5. Family d.110.9.1: GlcG-like [143745] (1 protein)
   Pfam PF03928; DUF336

6. Protein DhaI homolog [143746] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [143747] (1 PDB entry)

8. Domain d2a2lb1: 2a2l B:4-145 [126036]
   automatically matched to 2A2L A:4-145

Details for d2a2lb1

PDB Entry: 2a2l, 2.2 Å

PDB Description: crystal structure of klebsiella pneumoniae protein orfy, pfam duf336

PDB Compounds: (B:) unknown

SCOP Domain Sequences for d2a2lb1:

Sequence; same for both SEQRES and ATOM records:

>d2a2lb1 d.110.9.1 (B:4-145) DhaI homolog {Klebsiella pneumoniae [TaxId: 573]}
mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
sggtveqdqllaqcaldcfsal

Timeline for d2a2lb1:

• d2a2lb1 is new in SCOP 1.73
  
• d2a2lb1 appears in SCOP 1.75
  
• d2a2lb1 appears in the current release, SCOPe 2.08, called d2a2lb2