SCOPe 2.06: Domain d2a2jb2: 2a2j B:24-224

Lineage for d2a2jb2 (2a2j B:24-224)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Mycobacterium tuberculosis [TaxId:1773] [141347] (1 PDB entry)
   Uniprot P65682 24-112

8. Domain d2a2jb2: 2a2j B:24-224 [126034]
   Other proteins in same PDB: d2a2ja2, d2a2jb3
   automated match to d2a2ja1

Details for d2a2jb2

PDB Entry: 2a2j, 2.5 Å

PDB Description: Crystal structure of a putative pyridoxine 5'-phosphate oxidase (Rv2607) from Mycobacterium tuberculosis

PDB Compounds: (B:) Pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d2a2jb2:

Sequence; same for both SEQRES and ATOM records:

>d2a2jb2 b.45.1.1 (B:24-224) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacterium tuberculosis [TaxId: 1773]}
pekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckil
desgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrp
rgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqg
renrmhnrirvangrlerlqp

Timeline for d2a2jb2:

• d2a2jb2 first appeared in SCOP 1.73, called d2a2jb1
  
• d2a2jb2 was called d2a2jb_ in SCOPe 2.05
  
• d2a2jb2 appears in SCOPe 2.07
  
• d2a2jb2 appears in the current release, SCOPe 2.08