![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species) elaborated with additional secondary structures; active as dimer |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141347] (1 PDB entry) Uniprot P65682 24-112 |
![]() | Domain d2a2jb2: 2a2j B:24-224 [126034] Other proteins in same PDB: d2a2ja2, d2a2jb3 automated match to d2a2ja1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2a2j (more details), 2.5 Å
SCOPe Domain Sequences for d2a2jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2jb2 b.45.1.1 (B:24-224) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacterium tuberculosis [TaxId: 1773]} pekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckil desgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrp rgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqg renrmhnrirvangrlerlqp
Timeline for d2a2jb2: