Lineage for d2a29a1 (2a29 A:316-451)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740349Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 740350Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 740351Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 740373Protein Potassium-transporting ATPase B chain, KdpB [111270] (1 species)
    minimal fold of this domain:
  7. 740374Species Escherichia coli [TaxId:562] [111271] (4 PDB entries)
  8. 740378Domain d2a29a1: 2a29 A:316-451 [126030]
    automatically matched to d1svja_
    complexed with anp

Details for d2a29a1

PDB Entry: 2a29 (more details)

PDB Description: the solution structure of the amp-pnp bound nucleotide binding domain of kdpb
PDB Compounds: (A:) Potassium-transporting ATPase B chain

SCOP Domain Sequences for d2a29a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]}
nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
gsrvlgvialkdivkg

SCOP Domain Coordinates for d2a29a1:

Click to download the PDB-style file with coordinates for d2a29a1.
(The format of our PDB-style files is described here.)

Timeline for d2a29a1: