Lineage for d2a22b_ (2a22 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938484Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 1938502Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 1938503Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry)
    Uniprot Q5CYJ7 5-197
  8. 1938505Domain d2a22b_: 2a22 B: [126026]
    automated match to d2a22a1

Details for d2a22b_

PDB Entry: 2a22 (more details), 2.2 Å

PDB Description: Structure of Vacuolar Protein Sorting 29 from Cryptosporidium Parvum
PDB Compounds: (B:) vacuolar protein sorting 29

SCOPe Domain Sequences for d2a22b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a22b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}
glvprgssstdfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyve
mlknitknvyivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgs
leqwqrrldcdilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgn
kvvlyvydlrdgktnvamsefsk

SCOPe Domain Coordinates for d2a22b_:

Click to download the PDB-style file with coordinates for d2a22b_.
(The format of our PDB-style files is described here.)

Timeline for d2a22b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a22a1