Lineage for d2a22b1 (2a22 B:4-196)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736785Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 736786Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 736895Family d.159.1.7: YfcE-like [111233] (3 proteins)
  6. 736914Protein Vacuolar protein sorting 29, VPS29 [143935] (2 species)
  7. 736915Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry)
  8. 736917Domain d2a22b1: 2a22 B:4-196 [126026]
    automatically matched to 2A22 A:4-196

Details for d2a22b1

PDB Entry: 2a22 (more details), 2.2 Å

PDB Description: Structure of Vacuolar Protein Sorting 29 from Cryptosporidium Parvum
PDB Compounds: (B:) vacuolar protein sorting 29

SCOP Domain Sequences for d2a22b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a22b1 d.159.1.7 (B:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}
dfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyvemlknitknvy
ivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgsleqwqrrldc
dilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgnkvvlyvydlr
dgktnvamsefsk

SCOP Domain Coordinates for d2a22b1:

Click to download the PDB-style file with coordinates for d2a22b1.
(The format of our PDB-style files is described here.)

Timeline for d2a22b1: