Lineage for d2a22a1 (2a22 A:4-196)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2232176Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2232194Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 2232195Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry)
    Uniprot Q5CYJ7 5-197
  8. 2232196Domain d2a22a1: 2a22 A:4-196 [126025]
    Other proteins in same PDB: d2a22b3

Details for d2a22a1

PDB Entry: 2a22 (more details), 2.2 Å

PDB Description: Structure of Vacuolar Protein Sorting 29 from Cryptosporidium Parvum
PDB Compounds: (A:) vacuolar protein sorting 29

SCOPe Domain Sequences for d2a22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}
dfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyvemlknitknvy
ivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgsleqwqrrldc
dilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgnkvvlyvydlr
dgktnvamsefsk

SCOPe Domain Coordinates for d2a22a1:

Click to download the PDB-style file with coordinates for d2a22a1.
(The format of our PDB-style files is described here.)

Timeline for d2a22a1: