![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.7: YfcE-like [111233] (5 proteins) |
![]() | Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) |
![]() | Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry) Uniprot Q5CYJ7 5-197 |
![]() | Domain d2a22a1: 2a22 A:4-196 [126025] |
PDB Entry: 2a22 (more details), 2.2 Å
SCOPe Domain Sequences for d2a22a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} dfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyvemlknitknvy ivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgsleqwqrrldc dilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgnkvvlyvydlr dgktnvamsefsk
Timeline for d2a22a1: