Lineage for d2a21b_ (2a21 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086149Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)
  7. 2086150Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)
  8. 2086162Domain d2a21b_: 2a21 B: [126024]
    automated match to d1pe1a_
    complexed with pep, po4, zn

Details for d2a21b_

PDB Entry: 2a21 (more details), 1.8 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2a21b_:

Sequence, based on SEQRES records: (download)

>d2a21b_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlplsq
legiieaileirevaskyyeti

Sequence, based on observed residues (ATOM records): (download)

>d2a21b_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiiea
ileirevaskyyeti

SCOPe Domain Coordinates for d2a21b_:

Click to download the PDB-style file with coordinates for d2a21b_.
(The format of our PDB-style files is described here.)

Timeline for d2a21b_: