Lineage for d2a21a1 (2a21 A:1002-1264)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684412Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 684493Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 684494Species Aquifex aeolicus [TaxId:63363] [63922] (18 PDB entries)
  8. 684497Domain d2a21a1: 2a21 A:1002-1264 [126023]
    automatically matched to d1pe1a_
    complexed with pep, po4, zn

Details for d2a21a1

PDB Entry: 2a21 (more details), 1.8 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOP Domain Sequences for d2a21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a21a1 c.1.10.4 (A:1002-1264) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

SCOP Domain Coordinates for d2a21a1:

Click to download the PDB-style file with coordinates for d2a21a1.
(The format of our PDB-style files is described here.)

Timeline for d2a21a1: