Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins) |
Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species) |
Species Aquifex aeolicus [TaxId:63363] [63922] (18 PDB entries) |
Domain d2a21a1: 2a21 A:1002-1264 [126023] automatically matched to d1pe1a_ complexed with pep, po4, zn |
PDB Entry: 2a21 (more details), 1.8 Å
SCOP Domain Sequences for d2a21a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a21a1 c.1.10.4 (A:1002-1264) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls qlegiieaileirevaskyyeti
Timeline for d2a21a1: