SCOPe 2.08: Domain d2a21a_: 2a21 A:

Lineage for d2a21a_ (2a21 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)

8. Domain d2a21a_: 2a21 A: [126023]
   automated match to d1pe1a_
   complexed with pep, po4, zn

Details for d2a21a_

PDB Entry: 2a21, 1.8 Å

PDB Description: aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+

PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2a21a_:

Sequence; same for both SEQRES and ATOM records:

>d2a21a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Timeline for d2a21a_:

• d2a21a_ first appeared in SCOP 1.73, called d2a21a1
  
• d2a21a_ appears in SCOPe 2.07