Lineage for d2a1xa1 (2a1x A:43-338)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404861Family b.82.2.9: PhyH-like [141623] (3 protein domains)
    Pfam PF05721
  6. 2404862Protein Phytanoyl-CoA dioxygenase, PhyH [141626] (1 species)
  7. 2404863Species Human (Homo sapiens) [TaxId:9606] [141627] (1 PDB entry)
    Uniprot O14832 43-338
  8. 2404864Domain d2a1xa1: 2a1x A:43-338 [126022]
    complexed with akg, fe2

Details for d2a1xa1

PDB Entry: 2a1x (more details), 2.5 Å

PDB Description: human phytanoyl-coa 2-hydroxylase in complex with iron and 2- oxoglutarate
PDB Compounds: (A:) Phytanoyl-CoA dioxygenase

SCOPe Domain Sequences for d2a1xa1:

Sequence, based on SEQRES records: (download)

>d2a1xa1 b.82.2.9 (A:43-338) Phytanoyl-CoA dioxygenase, PhyH {Human (Homo sapiens) [TaxId: 9606]}
qfqytldnnvltleqrkfyeengflviknlvpdadiqrfrnefekicrkevkplgltvmr
dvtiskseyapsekmitkvqdfqedkelfryctlpeilkyvecftgpnimamhtmlinkp
pdsgkktsrhplhqdlhyfpfrpsdlivcawtamehisrnngclvvlpgthkgslkphdy
pkweggvnkmfhgiqdyeenkarvhlvmekgdtvffhpllihgsgqnktqgfrkaischf
asadchyidvkgtsqeniekevvgiahkffgaensvnlkdiwmfrarlvkgertnl

Sequence, based on observed residues (ATOM records): (download)

>d2a1xa1 b.82.2.9 (A:43-338) Phytanoyl-CoA dioxygenase, PhyH {Human (Homo sapiens) [TaxId: 9606]}
qfqytldnltleqrkfyeengflviknlvpdadiqrfrnefekicrkevkplgltvmrdv
tisksekmitkvqdfqedkelfryctlpeilkyvecftgpnimamhtmlinkppdplhqd
lhyfpfrpsdlivcawtamehisrnngclvvlpgthkgslkphdyhgiqdeenkarvhlv
mekgdtvffhpllihgsgqnktqgfrkaischfasadchyidvkgtsqenieknlkdiwm
frarlvkgertnl

SCOPe Domain Coordinates for d2a1xa1:

Click to download the PDB-style file with coordinates for d2a1xa1.
(The format of our PDB-style files is described here.)

Timeline for d2a1xa1: