SCOPe 2.08: Domain d2a1wh_: 2a1w H:

Lineage for d2a1wh_ (2a1w H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2a1wh_: 2a1w H: [126020]
   Other proteins in same PDB: d2a1wl2, d2a1wm2
   automated match to d6shgh_
   complexed with so4

Details for d2a1wh_

PDB Entry: 2a1w, 2.7 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form i

PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d2a1wh_:

Sequence; same for both SEQRES and ATOM records:

>d2a1wh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d2a1wh_:

• d2a1wh_ first appeared in SCOP 1.73, called d2a1wh1
  
• d2a1wh_ was called d2a1wh1 in SCOPe 2.07