![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.3: YjbR-like [142906] (1 family) ![]() overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet automatically mapped to Pfam PF04237 |
![]() | Family d.198.3.1: YjbR-like [142907] (2 proteins) Pfam PF04237; DUF419 |
![]() | Protein Hypothetical protein DR2400 [142908] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [142909] (1 PDB entry) Uniprot Q9RRT5 2-132 |
![]() | Domain d2a1va1: 2a1v A:4-134 [126019] Other proteins in same PDB: d2a1va2, d2a1va3 |
PDB Entry: 2a1v (more details), 2.15 Å
SCOPe Domain Sequences for d2a1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1va1 d.198.3.1 (A:4-134) Hypothetical protein DR2400 {Deinococcus radiodurans [TaxId: 1299]} qtpmqtvddlrsvcdelphsletfpfddetlvfkvgylsksrmyaltditqdplrlslkv dpergeelrqahpqsiapgyhlnkkhwvtvtldgtvpaellgellrgsyllvtkkgftka erkelglpdsl
Timeline for d2a1va1: