SCOP 1.73: Domain d2a1ua2: 2a1u A:209-331

Lineage for d2a1ua2 (2a1u A:209-331)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
   lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain

6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52473] (3 PDB entries)

8. Domain d2a1ua2: 2a1u A:209-331 [126017]
   Other proteins in same PDB: d2a1ua1, d2a1ub1
   automatically matched to d1efva2
   complexed with amp, fad; mutant

Details for d2a1ua2

PDB Entry: 2a1u, 2.11 Å

PDB Description: crystal structure of the human etf e165betaa mutant

PDB Compounds: (A:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOP Domain Sequences for d2a1ua2:

Sequence; same for both SEQRES and ATOM records:

>d2a1ua2 c.31.1.2 (A:209-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
rpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtgk
ivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemte
ilk

Timeline for d2a1ua2:

• d2a1ua2 is new in SCOP 1.73
  
• d2a1ua2 appears in SCOP 1.75
  
• d2a1ua2 appears in the current release, SCOPe 2.08