Lineage for d2a1ua2 (2a1u A:209-331)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694247Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
    lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain
  6. 694248Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)
  7. 694249Species Human (Homo sapiens) [TaxId:9606] [52473] (3 PDB entries)
  8. 694251Domain d2a1ua2: 2a1u A:209-331 [126017]
    Other proteins in same PDB: d2a1ua1, d2a1ub1
    automatically matched to d1efva2
    complexed with amp, fad; mutant

Details for d2a1ua2

PDB Entry: 2a1u (more details), 2.11 Å

PDB Description: crystal structure of the human etf e165betaa mutant
PDB Compounds: (A:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOP Domain Sequences for d2a1ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1ua2 c.31.1.2 (A:209-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
rpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtgk
ivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemte
ilk

SCOP Domain Coordinates for d2a1ua2:

Click to download the PDB-style file with coordinates for d2a1ua2.
(The format of our PDB-style files is described here.)

Timeline for d2a1ua2:

Domains from same chain:
(mouse over for more information)
d2a1ua1
Domains from other chains:
(mouse over for more information)
d2a1ub1