SCOPe 2.08: Domain d2a1ua2: 2a1u A:208-333

Lineage for d2a1ua2 (2a1u A:208-333)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d2a1ua2: 2a1u A:208-333 [126017]
   Other proteins in same PDB: d2a1ua1, d2a1ub_
   automated match to d1efva2
   complexed with amp, fad; mutant

Details for d2a1ua2

PDB Entry: 2a1u, 2.11 Å

PDB Description: crystal structure of the human etf e165betaa mutant

PDB Compounds: (A:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOPe Domain Sequences for d2a1ua2:

Sequence; same for both SEQRES and ATOM records:

>d2a1ua2 c.31.1.0 (A:208-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtg
kivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemt
eilkkk

Timeline for d2a1ua2:

• d2a1ua2 first appeared in SCOP 1.73
  
• d2a1ua2 appears in SCOPe 2.07