SCOPe 2.08: Domain d2a1ua1: 2a1u A:19-207

Lineage for d2a1ua1 (2a1u A:19-207)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein automated matches [190188] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186927] (2 PDB entries)

8. Domain d2a1ua1: 2a1u A:19-207 [126016]
   Other proteins in same PDB: d2a1ua2
   automated match to d1efva1
   complexed with amp, fad; mutant

Details for d2a1ua1

PDB Entry: 2a1u, 2.11 Å

PDB Description: crystal structure of the human etf e165betaa mutant

PDB Compounds: (A:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOPe Domain Sequences for d2a1ua1:

Sequence; same for both SEQRES and ATOM records:

>d2a1ua1 c.26.2.3 (A:19-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlv
aqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiai
kspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveise
wldqkltks

Timeline for d2a1ua1:

• d2a1ua1 first appeared in SCOP 1.73
  
• d2a1ua1 appears in SCOPe 2.07