Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d2a1tr2 (2a1t R:209-331)

  1. Root: SCOP 1.75
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
    lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain
  6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52473] (3 PDB entries)
  8. Domain d2a1tr2: 2a1t R:209-331 [126014]
    Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr1, d2a1ts1
    automatically matched to d1efva2
    complexed with amp, fad; mutant

Details for d2a1tr2

PDB Entry: 2a1t (more details)
PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (R:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOP Domain Sequences for d2a1tr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1tr2 c.31.1.2 (R:209-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
rpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtgk
ivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemte
ilk

SCOP Domain Coordinates for d2a1tr2:

Click to download the PDB-style file with coordinates for d2a1tr2.
(The format of our PDB-style files is described here.)

Timeline for d2a1tr2:

d2a1tr2 appears in SCOP 1.73
d2a1tr2 appears in SCOP 1.75A


d2a1tr2
(click for larger image)


d2a1tr2 in context of chain
Domains from same chain:
d2a1tr1


d2a1tr2 in context of PDB
Domains from other chains:
d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1ts1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu