![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
![]() | Protein automated matches [190188] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186927] (2 PDB entries) |
![]() | Domain d2a1tr1: 2a1t R:18-205 [126013] Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr2, d2a1ts1 automated match to d1efva1 complexed with amp, fad |
PDB Entry: 2a1t (more details), 2.8 Å
SCOPe Domain Sequences for d2a1tr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1tr1 c.26.2.3 (R:18-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} rfqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvl vaqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiia ikspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveis ewldqklt
Timeline for d2a1tr1: