SCOP 1.73: Domain d2a1tr1: 2a1t R:20-205

Lineage for d2a1tr1 (2a1t R:20-205)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (2 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding domain of DHS-like fold

7. Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries)

8. Domain d2a1tr1: 2a1t R:20-205 [126013]
   Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr2, d2a1ts1
   automatically matched to d1efva1
   complexed with amp, fad; mutant

Details for d2a1tr1

PDB Entry: 2a1t, 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex

PDB Compounds: (R:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOP Domain Sequences for d2a1tr1:

Sequence; same for both SEQRES and ATOM records:

>d2a1tr1 c.26.2.3 (R:20-205) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqklt

Timeline for d2a1tr1:

• d2a1tr1 is new in SCOP 1.73
  
• d2a1tr1 appears in SCOP 1.75
  
• d2a1tr1 appears in the current release, SCOPe 2.07