Lineage for d2a1tr1 (2a1t R:20-205)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693721Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 693839Family c.26.2.3: ETFP subunits [52432] (2 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 693840Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 693841Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries)
  8. 693844Domain d2a1tr1: 2a1t R:20-205 [126013]
    Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr2, d2a1ts1
    automatically matched to d1efva1
    complexed with amp, fad; mutant

Details for d2a1tr1

PDB Entry: 2a1t (more details), 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (R:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOP Domain Sequences for d2a1tr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1tr1 c.26.2.3 (R:20-205) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqklt

SCOP Domain Coordinates for d2a1tr1:

Click to download the PDB-style file with coordinates for d2a1tr1.
(The format of our PDB-style files is described here.)

Timeline for d2a1tr1: