Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d2a1tc2 (2a1t C:10-241)

  1. Root: SCOP 1.75
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 protein domains)
  6. Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
    Uniprot P11310 34-421
  8. Domain d2a1tc2: 2a1t C:10-241 [126010]
    Other proteins in same PDB: d2a1ta1, d2a1tb1, d2a1tc1, d2a1td1, d2a1tr1, d2a1tr2, d2a1ts1
    automatically matched to d1egca2
    complexed with amp, fad; mutant

Details for d2a1tc2

PDB Entry: 2a1t (more details)
PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (C:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOP Domain Sequences for d2a1tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1tc2 e.6.1.1 (C:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d2a1tc2:

Click to download the PDB-style file with coordinates for d2a1tc2.
(The format of our PDB-style files is described here.)

Timeline for d2a1tc2:

d2a1tc2 appears in SCOP 1.73
d2a1tc2 appears in SCOP 1.75A


d2a1tc2
(click for larger image)


d2a1tc2 in context of chain
Domains from same chain:
d2a1tc1


d2a1tc2 in context of PDB
Domains from other chains:
d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1td1, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu