SCOP 1.73: Domain d2a1tc1: 2a1t C:242-395

Lineage for d2a1tc1 (2a1t C:242-395)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)

8. Domain d2a1tc1: 2a1t C:242-395 [126009]
   Other proteins in same PDB: d2a1ta2, d2a1tb2, d2a1tc2, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1
   automatically matched to d1egca1
   complexed with amp, fad; mutant

Details for d2a1tc1

PDB Entry: 2a1t, 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex

PDB Compounds: (C:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOP Domain Sequences for d2a1tc1:

Sequence; same for both SEQRES and ATOM records:

>d2a1tc1 a.29.3.1 (C:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

Timeline for d2a1tc1:

• d2a1tc1 is new in SCOP 1.73
  
• d2a1tc1 appears in SCOP 1.75
  
• d2a1tc1 appears in the current release, SCOPe 2.08