Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein automated matches [226961] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries) |
Domain d2a1ta2: 2a1t A:10-241 [126006] Other proteins in same PDB: d2a1ta1, d2a1tb1, d2a1tc1, d2a1td1, d2a1tr1, d2a1tr2, d2a1ts1 automated match to d1egda2 complexed with amp, fad |
PDB Entry: 2a1t (more details), 2.8 Å
SCOPe Domain Sequences for d2a1ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1ta2 e.6.1.1 (A:10-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd
Timeline for d2a1ta2: