Lineage for d2a1la1 (2a1l A:2-271)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539216Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
    automatically mapped to Pfam PF02121
  6. 2539217Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species)
  7. 2539227Species Norway rat (Rattus norvegicus), beta isoform [TaxId:10116] [143821] (1 PDB entry)
    Uniprot P53812 1-270
  8. 2539228Domain d2a1la1: 2a1l A:2-271 [126002]
    complexed with pcw

Details for d2a1la1

PDB Entry: 2a1l (more details), 2.18 Å

PDB Description: Rat PITP-Beta Complexed to Phosphatidylcholine
PDB Compounds: (A:) Phosphatidylinositol transfer protein beta isoform

SCOPe Domain Sequences for d2a1la1:

Sequence, based on SEQRES records: (download)

>d2a1la1 d.129.3.4 (A:2-271) Phoshatidylinositol transfer protein, PITP {Norway rat (Rattus norvegicus), beta isoform [TaxId: 10116]}
vlikefrvvlpcsvqeyqvgqlysvaeasknetgggegievlknepyendgekgqythki
yhlkskvpafvrmiapegslvfhekawnaypycrtivtneymkddffikietwhkpdlgt
lenvhgldpntwktveivhidiadrsqvepadykadedpalfqsvktkrgplgpnwkkel
antpdcpkmcayklvtikfkwwglqskvenfiqkqekriftnlhrqlfcwidkwidltme
dirrmedetqkeletmrkkgsvrgtsaada

Sequence, based on observed residues (ATOM records): (download)

>d2a1la1 d.129.3.4 (A:2-271) Phoshatidylinositol transfer protein, PITP {Norway rat (Rattus norvegicus), beta isoform [TaxId: 10116]}
vlikefrvvlpcsvqeyqvgqlysvaeasknetgggegievlknepyendgekgqythki
yhlkskvpafvrmiapegslvfhekawnaypycrtivtneymkddffikietwhkpdlgt
lenvhgldpntwktveivhidiadrsqvepadykadedpalfqsvktkrgplgpnwkkel
antpcpkmcayklvtikfkwwglqskvenfiqkqekriftnlhrqlfcwidkwidltmed
irrmedetqkeletmrkkgsvrgtsaada

SCOPe Domain Coordinates for d2a1la1:

Click to download the PDB-style file with coordinates for d2a1la1.
(The format of our PDB-style files is described here.)

Timeline for d2a1la1: