Lineage for d2a1hb1 (2a1h B:3-365)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743714Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 743715Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (1 family) (S)
  5. 743716Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (3 proteins)
  6. 743722Protein Branched-chain aminoacid aminotransferase [56757] (2 species)
  7. 743742Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (7 PDB entries)
  8. 743744Domain d2a1hb1: 2a1h B:3-365 [125998]
    automatically matched to d1ekfa_
    complexed with acy, gbn, plp

Details for d2a1hb1

PDB Entry: 2a1h (more details), 1.8 Å

PDB Description: x-ray crystal structure of human mitochondrial branched chain aminotransferase (bcatm) complexed with gabapentin
PDB Compounds: (B:) branched chain aminotransferase

SCOP Domain Sequences for d2a1hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1hb1 e.17.1.1 (B:3-365) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
fpv

SCOP Domain Coordinates for d2a1hb1:

Click to download the PDB-style file with coordinates for d2a1hb1.
(The format of our PDB-style files is described here.)

Timeline for d2a1hb1: