SCOPe 2.07: Domain d2a1ha_: 2a1h A:

Lineage for d2a1ha_ (2a1h A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein automated matches [190187] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186926] (6 PDB entries)

8. Domain d2a1ha_: 2a1h A: [125997]
   automated match to d1ekfa_
   complexed with acy, gbn, plp

Details for d2a1ha_

PDB Entry: 2a1h, 1.8 Å

PDB Description: x-ray crystal structure of human mitochondrial branched chain aminotransferase (bcatm) complexed with gabapentin

PDB Compounds: (A:) branched chain aminotransferase

SCOPe Domain Sequences for d2a1ha_:

Sequence; same for both SEQRES and ATOM records:

>d2a1ha_ e.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
fpv

Timeline for d2a1ha_:

• d2a1ha_ first appeared in SCOP 1.73, called d2a1ha1
  
• d2a1ha_ appears in SCOPe 2.06
  
• d2a1ha_ appears in the current release, SCOPe 2.08