Lineage for d2a1ff2 (2a1f F:2-239)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905225Protein Uridylate kinase PyrH [142728] (6 species)
  7. 2905231Species Haemophilus influenzae [TaxId:727] [142733] (1 PDB entry)
    Uniprot P43890 2-237
  8. 2905237Domain d2a1ff2: 2a1f F:2-239 [125996]
    Other proteins in same PDB: d2a1fa2, d2a1fa3, d2a1fb3, d2a1fb4, d2a1fc3, d2a1fd3, d2a1fe3, d2a1ff3
    automated match to d2a1fa1

Details for d2a1ff2

PDB Entry: 2a1f (more details), 2.1 Å

PDB Description: crystal structure of uridylate kinase
PDB Compounds: (F:) uridylate kinase

SCOPe Domain Sequences for d2a1ff2:

Sequence, based on SEQRES records: (download)

>d2a1ff2 c.73.1.3 (F:2-239) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]}
sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpdakly
knlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeg

Sequence, based on observed residues (ATOM records): (download)

>d2a1ff2 c.73.1.3 (F:2-239) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]}
sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsyae
vidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeg

SCOPe Domain Coordinates for d2a1ff2:

Click to download the PDB-style file with coordinates for d2a1ff2.
(The format of our PDB-style files is described here.)

Timeline for d2a1ff2: