Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
Protein Carboxysome shell protein CcmK2 [143420] (2 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [143421] (1 PDB entry) Uniprot P72761 1-101 |
Domain d2a1bg_: 2a1b G: [125983] automated match to d2a1ba1 |
PDB Entry: 2a1b (more details), 2.9 Å
SCOPe Domain Sequences for d2a1bg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1bg_ d.58.56.1 (G:) Carboxysome shell protein CcmK2 {Synechocystis sp. PCC 6803 [TaxId: 1148]} siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
Timeline for d2a1bg_: