Lineage for d2a1bf1 (2a1b F:2-102)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726162Superfamily d.58.56: CcmK-like [143414] (1 family) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 726163Family d.58.56.1: CcmK-like [143415] (3 proteins)
    Pfam PF00936; BMC domain
  6. 726164Protein Carboxysome shell protein CcmK2 [143420] (1 species)
  7. 726165Species Synechocystis sp. PCC 6803 [TaxId:1148] [143421] (1 PDB entry)
  8. 726171Domain d2a1bf1: 2a1b F:2-102 [125982]
    automatically matched to 2A1B A:2-102
    mutant

Details for d2a1bf1

PDB Entry: 2a1b (more details), 2.9 Å

PDB Description: carboxysome shell protein ccmk2
PDB Compounds: (F:) Carbon dioxide concentrating mechanism protein ccmK homolog 2

SCOP Domain Sequences for d2a1bf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1bf1 d.58.56.1 (F:2-102) Carboxysome shell protein CcmK2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt

SCOP Domain Coordinates for d2a1bf1:

Click to download the PDB-style file with coordinates for d2a1bf1.
(The format of our PDB-style files is described here.)

Timeline for d2a1bf1: