Lineage for d2a1bb_ (2a1b B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. Protein Carboxysome shell protein CcmK2 [143420] (2 species)
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [143421] (1 PDB entry)
    Uniprot P72761 1-101
  8. Domain d2a1bb_: 2a1b B: [125978]
    automated match to d2a1ba1

Details for d2a1bb_

PDB Entry: 2a1b (more details), 2.9 Å

PDB Description: Carboxysome shell protein ccmK2
PDB Compounds: (B:) Carbon dioxide concentrating mechanism protein ccmK homolog 2

SCOPe Domain Sequences for d2a1bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1bb_ d.58.56.1 (B:) Carboxysome shell protein CcmK2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt

SCOPe Domain Coordinates for d2a1bb_ are not available.

Timeline for d2a1bb_:

Domains from other chains:
(mouse over for more information)
d2a1ba1, d2a1bc_, d2a1bd_, d2a1be_, d2a1bf_, d2a1bg_, d2a1bh_, d2a1bi_, d2a1bj_, d2a1bk_, d2a1bl_