Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (1 family) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.1: CcmK-like [143415] (3 proteins) Pfam PF00936; BMC domain |
Protein Carboxysome shell protein CcmK4 [143418] (1 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries) |
Domain d2a18b1: 2a18 B:4-107 [125975] automatically matched to 2A10 A:4-107 complexed with nh4 |
PDB Entry: 2a18 (more details), 2.28 Å
SCOP Domain Sequences for d2a18b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a18b1 d.58.56.1 (B:4-107) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]} qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi dainrtegadvktwviiprphenvvavlpidfspevepfreaae
Timeline for d2a18b1: