Lineage for d2a15a1 (2a15 A:5-136)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162085Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2162248Protein Hypothetical protein Rv0760c [142994] (2 species)
  7. 2162260Species Mycobacterium tuberculosis [TaxId:1773] [142995] (1 PDB entry)
    Uniprot P71817 5-136
  8. 2162261Domain d2a15a1: 2a15 A:5-136 [125973]
    complexed with nca

Details for d2a15a1

PDB Entry: 2a15 (more details), 1.68 Å

PDB Description: x-ray crystal structure of rv0760 from mycobacterium tuberculosis at 1.68 angstrom resolution
PDB Compounds: (A:) HYPOTHETICAL PROTEIN Rv0760c

SCOPe Domain Sequences for d2a15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]}
tqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaff
dthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnm
rgywnldmmtfg

SCOPe Domain Coordinates for d2a15a1:

Click to download the PDB-style file with coordinates for d2a15a1.
(The format of our PDB-style files is described here.)

Timeline for d2a15a1: