Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
Protein Indolethylamine N-methyltransferase, INMT [142577] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142578] (1 PDB entry) Uniprot O95050 5-261 |
Domain d2a14a1: 2a14 A:5-261 [125972] complexed with sah, so4 |
PDB Entry: 2a14 (more details), 1.7 Å
SCOPe Domain Sequences for d2a14a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} ftggdeyqkhflprdylatyysfdgspspeaemlkfnleclhktfgpgglqgdtlidigs gptiyqvlaacdsfqditlsdftdrnreelekwlkkepgaydwtpavkfacelegnsgrw eekeeklraavkrvlkcdvhlgnplapavlpladcvltllamecaccsldayraalcnla sllkpgghlvttvtlrlpsymvgkrefscvalekgeveqavldagfdieqllhspqsysv tnaanngvccivarkkp
Timeline for d2a14a1: