![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.8: Rv2717c-like [141475] (3 proteins) bacterial and plant proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF08768 |
![]() | Protein Hypothetical protein At1g79260 [141478] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (5 PDB entries) Uniprot O64527 14-166 |
![]() | Domain d2a13a1: 2a13 A:14-166 [125971] |
PDB Entry: 2a13 (more details), 1.32 Å
SCOPe Domain Sequences for d2a13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a13a1 b.60.1.8 (A:14-166) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr efelvdgklsyvvrmstttnplqphlkaildkl
Timeline for d2a13a1: