SCOP 1.75: Domain d2a10f1: 2a10 F:4-105

Lineage for d2a10f1 (2a10 F:4-105)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (1 family)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (3 proteins)
   Pfam PF00936; BMC domain

6. Protein Carboxysome shell protein CcmK4 [143418] (1 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries)
   Uniprot P73407 3-106

8. Domain d2a10f1: 2a10 F:4-105 [125970]
   automatically matched to 2A10 A:4-107

Details for d2a10f1

PDB Entry: 2a10, 1.8 Å

PDB Description: carboxysome shell protein ccmk4

PDB Compounds: (F:) Carbon dioxide concentrating mechanism protein ccmK homolog 4

SCOP Domain Sequences for d2a10f1:

Sequence; same for both SEQRES and ATOM records:

>d2a10f1 d.58.56.1 (F:4-105) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
dainrtegadvktwviiprphenvvavlpidfspevepfrea

Timeline for d2a10f1:

• d2a10f1 first appeared in SCOP 1.73
  
• d2a10f1 is called d2a10f_ in SCOPe 2.01
  
• d2a10f1 appears in the current release, SCOPe 2.08, called d2a10f_