Lineage for d2a10f_ (2a10 F:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. Protein Carboxysome shell protein CcmK4 [143418] (1 species)
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries)
    Uniprot P73407 3-106
  8. Domain d2a10f_: 2a10 F: [125970]
    automated match to d2a10a1

Details for d2a10f_

PDB Entry: 2a10 (more details), 1.8 Å

PDB Description: carboxysome shell protein ccmk4
PDB Compounds: (F:) Carbon dioxide concentrating mechanism protein ccmK homolog 4

SCOPe Domain Sequences for d2a10f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a10f_ d.58.56.1 (F:) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
agidainrtegadvktwviiprphenvvavlpidfspevepfrea

SCOPe Domain Coordinates for d2a10f_ are not available.

Timeline for d2a10f_:

Domains from other chains:
(mouse over for more information)
d2a10a1, d2a10b_, d2a10c_, d2a10d_, d2a10e_