Lineage for d2a10d1 (2a10 D:4-105)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726162Superfamily d.58.56: CcmK-like [143414] (1 family) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 726163Family d.58.56.1: CcmK-like [143415] (3 proteins)
    Pfam PF00936; BMC domain
  6. 726178Protein Carboxysome shell protein CcmK4 [143418] (1 species)
  7. 726179Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries)
  8. 726183Domain d2a10d1: 2a10 D:4-105 [125968]
    automatically matched to 2A10 A:4-107

Details for d2a10d1

PDB Entry: 2a10 (more details), 1.8 Å

PDB Description: carboxysome shell protein ccmk4
PDB Compounds: (D:) Carbon dioxide concentrating mechanism protein ccmK homolog 4

SCOP Domain Sequences for d2a10d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a10d1 d.58.56.1 (D:4-105) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
dainrtegadvktwviiprphenvvavlpidfspevepfrea

SCOP Domain Coordinates for d2a10d1:

Click to download the PDB-style file with coordinates for d2a10d1.
(The format of our PDB-style files is described here.)

Timeline for d2a10d1: