| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (1 family) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.1: CcmK-like [143415] (3 proteins) Pfam PF00936; BMC domain |
| Protein Carboxysome shell protein CcmK4 [143418] (1 species) |
| Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries) Uniprot P73407 3-106 |
| Domain d2a10c1: 2a10 C:4-107 [125967] automatically matched to 2A10 A:4-107 |
PDB Entry: 2a10 (more details), 1.8 Å
SCOP Domain Sequences for d2a10c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a10c1 d.58.56.1 (C:4-107) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
dainrtegadvktwviiprphenvvavlpidfspevepfreaae
Timeline for d2a10c1: