Lineage for d2a10a1 (2a10 A:4-107)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911709Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1911710Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 1911729Protein Carboxysome shell protein CcmK4 [143418] (1 species)
  7. 1911730Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries)
    Uniprot P73407 3-106
  8. 1911731Domain d2a10a1: 2a10 A:4-107 [125965]

Details for d2a10a1

PDB Entry: 2a10 (more details), 1.8 Å

PDB Description: carboxysome shell protein ccmk4
PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein ccmK homolog 4

SCOPe Domain Sequences for d2a10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a10a1 d.58.56.1 (A:4-107) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
dainrtegadvktwviiprphenvvavlpidfspevepfreaae

SCOPe Domain Coordinates for d2a10a1:

Click to download the PDB-style file with coordinates for d2a10a1.
(The format of our PDB-style files is described here.)

Timeline for d2a10a1: