| Class b: All beta proteins [48724] (178 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.2: FHA domain [49885] (12 proteins) |
| Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries) |
| Domain d2a0ta1: 2a0t A:14-164 [125964] automatically matched to d1g3ga_ |
PDB Entry: 2a0t (more details)
SCOPe Domain Sequences for d2a0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0ta1 b.26.1.2 (A:14-164) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir
Timeline for d2a0ta1: