Lineage for d2a0ta1 (2a0t A:14-164)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778138Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 2778139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)
  8. 2778144Domain d2a0ta1: 2a0t A:14-164 [125964]
    automatically matched to d1g3ga_

Details for d2a0ta1

PDB Entry: 2a0t (more details)

PDB Description: nmr structure of the fha1 domain of rad53 in complex with a biological relevant phosphopeptide derived from madt1
PDB Compounds: (A:) Serine/threonine-protein kinase RAD53

SCOPe Domain Sequences for d2a0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0ta1 b.26.1.2 (A:14-164) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

SCOPe Domain Coordinates for d2a0ta1:

Click to download the PDB-style file with coordinates for d2a0ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a0ta1: