SCOP 1.73: Domain d2a0sb1: 2a0s B:18-180

Lineage for d2a0sb1 (2a0s B:18-180)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (1 protein)

6. Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species)
   beta-sheets of three subunits form a barrel, closed: n=12, S=12

7. Species Plasmodium vivax [TaxId:5855] [143629] (1 PDB entry)
   73% similarity to the Plasmodium falciparum enzyme

8. Domain d2a0sb1: 2a0s B:18-180 [125963]
   automatically matched to 2A0S A:18-180
   complexed with bio, zn

Details for d2a0sb1

PDB Entry: 2a0s, 2.2 Å

PDB Description: Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution

PDB Compounds: (B:) 6-pyruvoyl tetrahydropterin synthase

SCOP Domain Sequences for d2a0sb1:

Sequence; same for both SEQRES and ATOM records:

>d2a0sb1 d.96.1.2 (B:18-180) 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax [TaxId: 5855]}
dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek
vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni

Timeline for d2a0sb1:

• d2a0sb1 is new in SCOP 1.73
  
• d2a0sb1 appears in SCOP 1.75
  
• d2a0sb1 appears in the current release, SCOPe 2.08, called d2a0sb_