Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (1 protein) |
Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species) beta-sheets of three subunits form a barrel, closed: n=12, S=12 |
Species Plasmodium vivax [TaxId:5855] [143629] (1 PDB entry) 73% similarity to the Plasmodium falciparum enzyme |
Domain d2a0sb1: 2a0s B:18-180 [125963] automatically matched to 2A0S A:18-180 complexed with bio, zn |
PDB Entry: 2a0s (more details), 2.2 Å
SCOP Domain Sequences for d2a0sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0sb1 d.96.1.2 (B:18-180) 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax [TaxId: 5855]} dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
Timeline for d2a0sb1: