SCOP 1.73: Domain d2a0na1: 2a0n A:2-251

Lineage for d2a0na1 (2a0n A:2-251)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries)

8. Domain d2a0na1: 2a0n A:2-251 [125961]
   automatically matched to d1vh7a_
   complexed with iod, po4, unl

Details for d2a0na1

PDB Entry: 2a0n, 1.64 Å

PDB Description: Crystal structure of Imidazole glycerol phosphate synthase subunit hisF (EC 4.1.3.-) (tm1036) from Thermotoga maritima at 1.64 A resolution

PDB Compounds: (A:) Imidazole glycerol phosphate synthase subunit hisF

SCOP Domain Sequences for d2a0na1:

Sequence; same for both SEQRES and ATOM records:

>d2a0na1 c.1.2.1 (A:2-251) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrle

Timeline for d2a0na1:

• d2a0na1 is new in SCOP 1.73
  
• d2a0na1 appears in SCOP 1.75
  
• d2a0na1 appears in the current release, SCOPe 2.08, called d2a0na_