SCOPe 2.02: Domain d2a0le1: 2a0l E:1-105

Lineage for d2a0le1 (2a0l E:1-105)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)

8. Domain d2a0le1: 2a0l E:1-105 [125958]
   Other proteins in same PDB: d2a0la1, d2a0lb1, d2a0ld1, d2a0lf1
   automatically matched to d1orsa1
   complexed with k

Details for d2a0le1

PDB Entry: 2a0l, 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex

PDB Compounds: (E:) 33H1 Fv fragment

SCOPe Domain Sequences for d2a0le1:

Sequence; same for both SEQRES and ATOM records:

>d2a0le1 b.1.1.1 (E:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkle

Timeline for d2a0le1:

• d2a0le1 first appeared in SCOP 1.73
  
• d2a0le1 appears in SCOPe 2.01
  
• d2a0le1 appears in SCOPe 2.03
  
• d2a0le1 appears in the current release, SCOPe 2.08