Lineage for d2a0ka1 (2a0k A:9-160)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840000Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1840001Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 1840002Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 1840008Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142064] (5 PDB entries)
    Uniprot Q57VC7 1-152
  8. 1840017Domain d2a0ka1: 2a0k A:9-160 [125954]
    complexed with gol, so4

Details for d2a0ka1

PDB Entry: 2a0k (more details), 1.8 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.8 a resolution
PDB Compounds: (A:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d2a0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0ka1 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc
daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg
fglpfnlmlydgvevfdsfesafkyflanfps

SCOPe Domain Coordinates for d2a0ka1:

Click to download the PDB-style file with coordinates for d2a0ka1.
(The format of our PDB-style files is described here.)

Timeline for d2a0ka1: