SCOPe 2.07: Domain d2a0fd1: 2a0f D:8-100

Lineage for d2a0fd1 (2a0f D:8-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d2a0fd1: 2a0f D:8-100 [125952]
   Other proteins in same PDB: d2a0fa1, d2a0fa2, d2a0fb2, d2a0fc1, d2a0fc2, d2a0fd2
   automated match to d1d09b1
   complexed with pct, zn; mutant

Details for d2a0fd1

PDB Entry: 2a0f, 2.9 Å

PDB Description: structure of d236a mutant e. coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2a0fd1:

Sequence; same for both SEQRES and ATOM records:

>d2a0fd1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
qveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2a0fd1:

• d2a0fd1 first appeared in SCOP 1.73
  
• d2a0fd1 appears in SCOPe 2.06
  
• d2a0fd1 appears in the current release, SCOPe 2.08